Cart summary

You have no items in your shopping cart.

CENPX Rabbit Polyclonal Antibody (FITC)

CENPX Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2108745

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2108745
CategoryAntibodies
DescriptionCENPX Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human STRA13
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW7kDa
UniProt IDA8MT69
Protein SequenceSynthetic peptide located within the following region: MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVD
NCBINP_659435
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesD9, MHF2, CENP-X, FAAP10, STRA13
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.