CENPQ Rabbit Polyclonal Antibody

• Catalog Number: orb583451
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CENPQ
• Target: CENPQ
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ
• Protein Sequence: Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL
• UniProt ID: Q7L2Z9
• MW: 30kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CENP-Q, C6orf139
• Note: For research use only
• NCBI: NP_060602

Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. CENPQ is supported by BioGPS gene expression data to be expressed in HEK293T.

Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. CENPQ is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-CENPQ Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.