You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583451 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CENPQ |
Target | CENPQ |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CENPQ |
Protein Sequence | Synthetic peptide located within the following region: VRNTVKKNKNHLKDLSSEGQTKHTNLKHGKTAASKRKTWQPLSKSTRDHL |
UniProt ID | Q7L2Z9 |
MW | 30kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | CENP-Q, C6orf139 |
Note | For research use only |
NCBI | NP_060602 |
Sample Type: Human 293T, Antibody dilution: 1.0 ug/ml. CENPQ is supported by BioGPS gene expression data to be expressed in HEK293T.
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. CENPQ is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Lung, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Fetal Muscle, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-CENPQ Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.
IF, IHC-Fr, IHC-P | |
Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |