CELA2A Rabbit Polyclonal Antibody

• Catalog Number: orb326230
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CEL2A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CEL2A
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 29kDa
• Target: CELA2A
• UniProt ID: P08217
• Protein Sequence: Synthetic peptide located within the following region: CNGDSGGPLNCQASDGRWQVHGIVSFGSRLGCNYYHKPSVFTRVSNYIDW
• NCBI: NP_254275
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti CELA2A antibody, anti ELA2A antibody, anti an
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Large intestine Tumor lysates, Antibody Dilution: 1.0 ug/mL.