You have no items in your shopping cart.
Cecropin B
SKU: orb2692706
Description
Images & Validation
−
Key Properties
−| Target | Cytochrome P450; Bacterial; Antibiotic |
|---|---|
| Molecular Weight | 3834.76 |
| Protein Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
| Purity | ≥95% |
Storage & Handling
−| Expiration Date | 6 months from date of receipt. |
|---|---|
| Disclaimer | For research use only |
Similar Products
−Cecropin B [orb1147114]
> 95% by HPLC
3834.7 Da
H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
1 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Quick Database Links
Gene Symbol
Cytochrome P450; Bacterial; Antibiotic
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Cecropin B (orb2692706)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review
