Cecropin B

• Catalog Number: orb1147114
• Category: Proteins
• Description: Broad spectrum insect antimicrobial peptide; Antibacterial; Antifungal; Antimicrobial peptides.
• CAS Number: 80451-05-4
• Form/Appearance: Freeze dried solid
• Purity: > 95% by HPLC
• MW: 3834.7 Da
• Formula: C₁₇₆H₃₀₂N₅₂O₄₁S
• Structure: H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2
• Solubility (25°C): Soluble in dilute acid
• Protein Sequence: KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2
• Storage: Store desiccated, frozen and in the dark
• Alternative names: , 80451-05-4, AMP , Cecropin B, H-KWKVFKKIEKMGRNIR
• Background: Cecropin B is a natural linear cationic α-helical antimicrobial peptide (AMP) originally identified in insects. Cecropin B has a wide spectrum of antimicrobial activities against gram-negative bacteria, gram-positive bacteria, and fungal phytopathogens, killing bacteria by affecting the integrity of the bacterial membranes. Cecropins constitute a main part of the innate immune system of insects.
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Structure for Cecropin B