Cart summary

You have no items in your shopping cart.

CEBPD Rabbit Polyclonal Antibody (FITC)

CEBPD Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2128815

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2128815
CategoryAntibodies
DescriptionCEBPD Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CEBPD
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW28kDa
UniProt IDP49716
Protein SequenceSynthetic peptide located within the following region: RNQEMQQKLVELSAENEKLHQRVEQLTRDLAGLRQFFKQLPSPPFLPAAG
NCBINP_005186
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCELF, CRP3, C/EBP-delta, NF-IL6-beta
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.