CDKL5 Rabbit Polyclonal Antibody

• Catalog Number: orb331071
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDKL5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CDKL5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 115 kDa
• Target: CDKL5
• UniProt ID: O76039
• Protein Sequence: Synthetic peptide located within the following region: SQASGGSSNIRQEPAPKGRPALQLPDGGCDGRRQRHHSGPQDRRFMLRTT
• NCBI: NP_003150
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ISSX antibody, anti STK9 antibody, anti EIEE2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml. Recognizes isoform 2 in this experiment.

WB Suggested Anti-CDKL5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate, CDKL5 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.