You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb587112 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to Cdk15 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Canine, Equine, Human, Porcine, Rabbit, Rat |
Reactivity | Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cdk15 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 47kDa |
Target | Cdk15 |
UniProt ID | Q3V3A1 |
Protein Sequence | Synthetic peptide located within the following region: ASFHPRGLEAASAQKLKSKRPRSNSDSFQEENLRQGLPWKKSLPFGAASS |
NCBI | NP_001028545 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | Als, Pftk, Pftk2, Als2cr7 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Mouse Mouse Brain, Antibody dilution: 1 ug/ml.
Sample Type: Mouse Brain lysates, Antibody dilution: 1.0 ug/ml.
WB | |
Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |