CDH22 Rabbit Polyclonal Antibody

• Catalog Number: orb580803
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CDH22
• Target: CDH22
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD
• UniProt ID: Q61751
• MW: 89 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: C20orf25, dJ998H6.1
• Note: For research use only
• NCBI: NP_033355

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 89 kDa, 78 kDa, 74 kDa and 55 kDa. Canonical isoform is processed to 87 kDa, and this protein may be subject to glycosylation.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Peptide is present in isoforms of 89 kDa, 78 kDa, 74 kDa and 55 kDa. Canonical isoform is processed to 87 kDa, and this protein may be subject to glycosylation.

WB Suggested Anti-CDH22 Antibody, Titration: 1.0 ug/ml, Positive Control: Hela Whole Cell.