You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb331123 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CD9 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Goat, Guinea pig, Porcine, Rabbit, Rat, Sheep |
Reactivity | Human, Mouse |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CD9 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 25 kDa |
Target | CD9 |
UniProt ID | P21926 |
Protein Sequence | Synthetic peptide located within the following region: KYLLFGFNFIFWLAGIAVLAIGLWLRFDSQTKSIFEQETNNNNSSFYTGV |
NCBI | NP_001760 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti 5H9 antibody, anti BA2 antibody, anti BTCC-1 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
25 ug of THP-1 whole cell extract was loaded onto a 12% SDS-PAGE gel. Blot was incubated with 3 ug/ml of antibody.
CD9 antibody - N-terminal region (orb331123) validated by WB using Fetal Heart Lysate at 1.0 ug/ml.
Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.
Sample Type: mouse fibroblast lusate (10 ug) Primary dilution: 1:2000 (1% BSA) Secondary dilution: 1:2000 (5% milk).
FC, WB | |
Bovine, Canine, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IF, IH, WB | |
Human, Mouse, Primate, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |