Cart summary

You have no items in your shopping cart.

    CD37 Antibody - middle region : FITC

    CD37 Antibody - middle region : FITC

    Catalog Number: orb2093463

    DispatchUsually dispatched within 5-10 working days
    $ 632.00
    Catalog Numberorb2093463
    CategoryAntibodies
    DescriptionCD37 Antibody - middle region : FITC
    Species/HostRabbit
    ClonalityPolyclonal
    Tested applicationsWB
    Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
    ConjugationFITC
    MW31kDa
    UniProt IDP11049
    Protein SequenceSynthetic peptide located within the following region: TIQKYGTNPEETAAEESWDYVQFQLRCCGWHYPQDWFQVLILRGNGSEAH
    NCBINP_001765
    StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
    Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
    Alternative namesGP52-40, TSPAN26
    Read more...
    NoteFor research use only
    Expiration Date12 months from date of receipt.
    Submit a review

    Filter by Rating

      • Star
      • Star
      • Star
      • Star
      • Star
      • 5 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 4 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 3 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 2 stars
      • Star
      • Star
      • Star
      • Star
      • Star
      • 1 stars