You have no items in your shopping cart.
Cart summary
Item 1 of 2
Item 1 of 2
CD109 Rabbit Polyclonal Antibody
Catalog Number: orb585874
| Catalog Number | orb585874 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to CD109 |
| Target | CD109 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Porcine, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: KLYWSKVKAEPSEKVSLRISVTQPDSIVGIVAVDKSVNLMNASNDITMEN |
| UniProt ID | Q6YHK3 |
| MW | 151kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | p180, r150, CPAMD7 |
| Note | For research use only |
| NCBI | NP_001153060 |
Positive control (+): HepG2 cell lysate (HG), Negative control (-): Human Liver (LI), Antibody concentration: 1 ug/ml.
WB Suggested Anti-CD109 Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
- Item 1 of 2
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
CD109 Rabbit Polyclonal Antibody (HRP) [orb2092823]
WB
Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat
Rabbit
Polyclonal
HRP
100 μl
