You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb586144 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCZ1 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 56kDa |
Target | CCZ1 |
UniProt ID | P86790 |
Protein Sequence | Synthetic peptide located within the following region: NKRMSGSEKEPQFKFIYFNHMNLAEKSTVHMRKTPSVSLTSVHPDLMKIL |
NCBI | NP_056437 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CCZ1A, CGI-43, C7orf28A, H_DJ1163J12.2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CCZ1 Antibody, Titration: 1.0 ug/ml, Positive Control: 293T Whole Cell. CCZ1 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.