CCT8 Rabbit Polyclonal Antibody

• Catalog Number: orb579589
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCT8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat, Yeast, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CCT8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 59kDa
• Target: CCT8
• UniProt ID: Q5RAP1
• Protein Sequence: Synthetic peptide located within the following region: DMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
• NCBI: NP_006576
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: Cctq, PRED71, D21S246, C21orf112
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

CCT8 antibody - C-terminal region (orb579589) validated by WB using HEK 293T at 1:1000 dilution for antibody samples and 1:10000 for secondary antibodies. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

CCT8 antibody - C-terminal region (orb579589) validated by WB using human lymphoblastoid & mouse brain.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Testis, Antibody dilution: 1 ug/ml.

WB Suggested Anti-CCT8 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. CCT8 is strongly supported by BioGPS gene expression data to be expressed in Jurkat.