You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325879 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCT6B |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CCT6B |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 58kDa |
Target | CCT6B |
UniProt ID | Q92526 |
Protein Sequence | Synthetic peptide located within the following region: VARTSLQTKVHAELADVLTEVVVDSVLAVRRPGYPIDLFMVEIMEMKHKL |
NCBI | NP_006575 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti CCT-zeta-2 antibody, anti CCTZ-2 antibody, an Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CCT4 Antibody Titration: 1 ug/mL, Lane 1: 10 ug of HEK293CCT6B is supported by BioGPS gene expression data to be expressed in HEK293T.
WB Suggested Anti-CCT6B Antibody Titration: 0.2-1 ug/mL, Positive Control: 721_B cell lysate.
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat | |
Rabbit | |
Polyclonal | |
FITC |