CCL8 Rabbit Polyclonal Antibody

• Catalog Number: orb592724
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CCL8
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CCL8
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 11 kDa
• Target: CCL8
• UniProt ID: P80075
• Protein Sequence: Synthetic peptide located within the following region: SYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
• NCBI: NP_005614
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HC14, MCP2, MCP-2, SCYA8, SCYA10
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment.

Positive control (+): Human Fetal Heart (HE), Negative control (-): HeLa Cell Lysate (HL), Antibody concentration: 1 ug/ml.

Rabbit Anti-CCL8 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Adrenal, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-CCL8 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: Human heart.