You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327163 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CCDC85C |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Human, Mouse, Rabbit, Zebrafish |
Reactivity | Human, Mouse, Zebrafish |
Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CCDC85C |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 46kDa |
Target | CCDC85C |
UniProt ID | A6NKD9 |
Protein Sequence | Synthetic peptide located within the following region: HLLEIRGLKDVNQRLQDDNQELRELCCFLDDDRQKGRKLAREWQRFGRHA |
NCBI | NP_001138467 |
Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Western blot analysis of human MCF7 tissue using CCDC85C antibody
WB | |
Animal, Bovine, Canine, Guinea pig, Human, Mouse, Zebrafish | |
Canine, Equine, Guinea pig, Human, Mouse, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
Filter by Rating