Cart summary

You have no items in your shopping cart.

CCDC60 Rabbit Polyclonal Antibody (HRP)

CCDC60 Rabbit Polyclonal Antibody (HRP)

Catalog Number: orb2107850

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2107850
CategoryAntibodies
DescriptionCCDC60 Rabbit Polyclonal Antibody (HRP)
ClonalityPolyclonal
Species/HostRabbit
ConjugationHRP
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Buffer/PreservativesLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human CCDC60
Protein SequenceSynthetic peptide located within the following region: RPAKKILVKLQKFGENLDLRIRPHVLLKVLQDLRIWELCSPDIAVAIEFV
UniProt IDQ8IWA6
MW63kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMGC39827
NoteFor research use only
NCBINP_848594