Cart summary

You have no items in your shopping cart.

Cbr2 Rabbit Polyclonal Antibody (Biotin)

Cbr2 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2122150

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2122150
CategoryAntibodies
DescriptionCbr2 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cbr2
Protein SequenceSynthetic peptide located within the following region: VCVDLGDWDATEKALGGIGPVDLLVNNAALVIMQPFLEVTKEAFDRSFSV
UniProt IDP08074
MW26kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesML, MLCR
NoteFor research use only
NCBINP_031647