CAVIN2 Rabbit Polyclonal Antibody

• Catalog Number: orb588709
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAVIN2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SDPR
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 47 kDa
• Target: CAVIN2
• UniProt ID: O95810
• Protein Sequence: Synthetic peptide located within the following region: QHPGSDMRQEKPSSPSPMPSSTPSPSLNLGNTEEAIRDNSQVNAVTVLTL
• NCBI: NP_004648.1
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: SDR, SDPR, PS-p68, cavin-2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: leiomyosarcoma lysates, Antibody Dilution: 1 ug/ml.