You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb580853 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CASD1 |
Target | CASD1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Mouse, Porcine, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human CASD1 |
Protein Sequence | Synthetic peptide located within the following region: MAALAYNLGKREINHYFSVRSAKVLALVAVLLLAACHLASRRYRGNDSCE |
UniProt ID | Q96PB1 |
MW | 91kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SOAT, C7orf12, NBLA04196 |
Note | For research use only |
NCBI | NP_075051 |
Sample Tissue: Human HT1080, Antibody dilution: 1.0 ug/ml.
WB Suggested Anti-CASD1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: THP-1 cell lysate.
WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Human, Mouse, Porcine, Rat | |
Rabbit | |
Polyclonal | |
Biotin |
ELISA, IF, IHC-Fr | |
Porcine, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |