CARD18 Rabbit Polyclonal Antibody

• Catalog Number: orb327210
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CARD18
• Target: CARD18
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen for Anti-CARD18 antibody is: synthetic peptide directed towards the middle region of Human CAR18
• Protein Sequence: Synthetic peptide located within the following region: DEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDP
• UniProt ID: P57730
• MW: 9 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti ICEBERG antibody, anti UNQ5804 antibody, anti
• Note: For research use only
• NCBI: NP_067546.1
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-CAR18 antibody Titration: 1 ug/mL, Sample Type: Human Ovary Tumor.