You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb327210 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CARD18 |
Target | CARD18 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Human |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen for Anti-CARD18 antibody is: synthetic peptide directed towards the middle region of Human CAR18 |
Protein Sequence | Synthetic peptide located within the following region: DEVISQEDMNKVRDENDTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDP |
UniProt ID | P57730 |
MW | 9 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti ICEBERG antibody, anti UNQ5804 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_067546.1 |
WB Suggested Anti-CAR18 antibody Titration: 1 ug/mL, Sample Type: Human Ovary Tumor.
ELISA, ICC, IF, IHC-Fr, IHC-P | |
Rabbit | |
Polyclonal | |
Unconjugated |