Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Page Not Found
Cart summary

You have no items in your shopping cart.

CAPN1 Rabbit Polyclonal Antibody

SKU: orb331113

Description

Rabbit polyclonal antibody to CAPN1

Research Area

Neuroscience

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human CAPN1
TargetCAPN1
Protein SequenceSynthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
Molecular Weight82kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

anti CANP antibody, anti CANP1 antibody, anti CANPL1 antibody, anti muCANP antibody, anti muCL antibody

Similar Products

  • Calpain 1/CAPN1 Rabbit Polyclonal Antibody [orb251513]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Anti-CAPN1 Rabbit Polyclonal Antibody [orb2569733]

    IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CAPN1 Rabbit Polyclonal Antibody [orb10219]

    FC,  IF,  IHC-Fr,  IHC-P

    Bovine, Gallus, Porcine, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Calpain 1/CAPN1 Rabbit Polyclonal Antibody [orb27577]

    ICC,  IF,  IHC,  IHC-Fr,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • CAPN1 Rabbit Polyclonal Antibody [orb625380]

    ELISA,  FC,  IF,  IHC,  IP,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CAPN1 Rabbit Polyclonal Antibody

CAPN1 antibody - middle region (orb331113) validated by WB using HT1080 cell lysate at 1 ug/ml.

CAPN1 Rabbit Polyclonal Antibody

Lanes: 1. 20 ug Jurkat cell lysate, 2. 20 ug Hut-78 cell lysate, 3. 20 ug K562 cell lysate, 4. 20 ug Raj cell lysate, 5. 20 ug U937 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: CAPN1.

CAPN1 Rabbit Polyclonal Antibody

Primary dilution: 1 ug/ml, Secondary dilution: 1:2000, Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells.

CAPN1 Rabbit Polyclonal Antibody

Rabbit Anti-CAPN1 Antibody, Catalog Number: orb331113, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005177

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CAPN1 Rabbit Polyclonal Antibody (orb331113)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 1 - 2 weeks
Bulk Enquiry