CAPN1 Rabbit Polyclonal Antibody

• Catalog Number: orb331113
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAPN1
• Target: CAPN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAPN1
• Protein Sequence: Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE
• UniProt ID: P07384
• MW: 82kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti CANP antibody, anti CANP1 antibody, anti CANP
• Research Area: Epigenetics, Neuroscience
• Note: For research use only
• NCBI: NP_005177

CAPN1 antibody - middle region (orb331113) validated by WB using HT1080 cell lysate at 1 ug/ml.

Lanes: 1. 20 ug Jurkat cell lysate, 2. 20 ug Hut-78 cell lysate, 3. 20 ug K562 cell lysate, 4. 20 ug Raj cell lysate, 5. 20 ug U937 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: CAPN1.

Primary dilution: 1 ug/ml, Secondary dilution: 1:2000, Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells.

Rabbit Anti-CAPN1 Antibody, Catalog Number: orb331113, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.