You have no items in your shopping cart.
CAPN1 Rabbit Polyclonal Antibody
SKU: orb331113
Description
Research Area
Epigenetics, Neuroscience
Images & Validation
−Item 1 of 4
| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Equine, Goat, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CAPN1 |
| Target | CAPN1 |
| Protein Sequence | Synthetic peptide located within the following region: EVEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLE |
| Molecular Weight | 82kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−anti CANP antibody, anti CANP1 antibody, anti CANPL1 antibody, anti muCANP antibody, anti muCL antibody
Similar Products
−- Item 1 of 1
- Item 1 of 4
Calpain 1/CAPN1 Rabbit Polyclonal Antibody [orb251513]
FC, ICC, IF, IHC, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μg 
Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
CAPN1 antibody - middle region (orb331113) validated by WB using HT1080 cell lysate at 1 ug/ml.
Lanes: 1. 20 ug Jurkat cell lysate, 2. 20 ug Hut-78 cell lysate, 3. 20 ug K562 cell lysate, 4. 20 ug Raj cell lysate, 5. 20 ug U937 cell lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:2000, Gene Name: CAPN1.
Primary dilution: 1 ug/ml, Secondary dilution: 1:2000, Tested with Hut-78, K562, Raj, U937, and Indomethacin Treated Jurkat cells.
Rabbit Anti-CAPN1 Antibody, Catalog Number: orb331113, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
Documents Download
Datasheet
Product Information
Request a Document
CAPN1 Rabbit Polyclonal Antibody (orb331113)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a ReviewAvailable Sizes
Select a size below
Usually dispatched within 1 - 2 weeks