Cart summary

You have no items in your shopping cart.

Canine IL-8 protein

SKU: orb1216335

Description

The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850).

Images & Validation

Key Properties

SourceYeast
Biological OriginCanine
TargetIL-8
Molecular Weight8.6 kDa
Protein Length74.0
Protein SequenceVSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CXCL8

Similar Products

  • Recombinant Canine Interleukin-8/CXCL8 [orb1906147]

    > 95 % by SDS-PAGE and HPLC analyses.

    Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 79 amino acids.

    Escherichia coli

    5 μg, 100 μg, 500 μg
  • Canine IL-8 protein [orb633364]

    ELISA,  WB

    Greater than 95% by SDS-PAGE gel analyses

    9.1 KDa

    E.Coli

    200 μg, 1 mg, 100 μg, 50 μg
  • Canine IL-8 ELISA Kit [orb2991709]

    Canine

    15.6-1,000 pg/mL

    <2 pg/mL

    96 T
  • k9IL8 Protein [orb1471905]

    Greater than 90.0% as determined by SDS-PAGE.

    HEK293 Cells

    100 μg, 10 μg, 2 μg
  • Canine IL 8 Protein [orb429416]

    Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.

    Escherichia Coli

    5 μg, 1 mg, 20 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Canine IL-8 protein (orb1216335)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

5 μg
$ 300.00
25 μg
$ 540.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry