You have no items in your shopping cart.
Cart summary
Canine IL-8 protein
Catalog Number: orb1216335
| Catalog Number | orb1216335 |
|---|---|
| Category | Proteins |
| Description | The Canine IL-8 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Canine IL-8 applications are for cell culture, ELISA standard, and Western Blot Control. The Canine IL-8 yeast-derived recombinant protein can be purchased in multiple sizes. Canine IL-8 Specifications: (Molecular Weight: 8.6 kDa) (Amino Acid Sequence: VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP) (Gene ID: 403850). |
| Form/Appearance | Lyophilized |
| Purity | 98% |
| MW | 8.6 kDa |
| Target | IL-8 |
| Protein Sequence | VSSELRCQCIKTHSTPFHPKYIKELRVIDSGPHCENSEIIVKLFNGNEVCLDPKEKWVQKVVQIFLKKAEKQDP |
| Protein Length | 74 |
| Source | Yeast |
| Biological Origin | Canine |
| Storage | -20°C |
| Alternative names | CXCL8 Read more... |
| Note | For research use only |
| Expiration Date | 6 months from date of receipt. |
- Item 1 of 1
Recombinant Canine Interleukin-8/CXCL8 [orb1906147]
> 95 % by SDS-PAGE and HPLC analyses.
Approximately 9.1 kDa, a single non-glycosylated polypeptide chain containing 79 amino acids.
Escherichia coli
100 μg, 5 μg, 500 μg - Item 1 of 1
Canine IL-8 protein [orb223877]
SDS-PAGE
Unconjugated
> 95% by SDS-PAGE and HPLC analyses.
9.1 kDa
E. coli
5 μg, 100 μg, 500 μg k9IL8 Protein [orb1471905]
Greater than 90.0% as determined by SDS-PAGE.
HEK293 Cells
100 μg, 2 μg, 10 μgCanine IL 8 Protein [orb429416]
Greater than 95.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Escherichia Coli
20 μg, 1 mg, 5 μgIL-8/CXCL8 Protein, Canine, Recombinant [orb1956674]
98.00%
9.2 kDa (predicted); 9 kDa (reducing condition, due to glycosylation)
50 μg
