CAMKK2 Rabbit Polyclonal Antibody

• Catalog Number: orb581980
• Category: Antibodies
• Description: Rabbit polyclonal antibody to CAMKK2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 55kDa
• Target: CAMKK2
• UniProt ID: Q96RR4
• Protein Sequence: Synthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
• NCBI: NP_705720
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: CAMKK, CAMKKB
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa.

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2.

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7.

WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B.