Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

CAMKK2 Rabbit Polyclonal Antibody

SKU: orb581980

Description

CAMKK2 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody for the detection of CAMKK2. It is suitable for WB application. The immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin, Immunology & Inflammation, Molecular Biology

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human CAMKK2
TargetCAMKK2
Protein SequenceSynthetic peptide located within the following region: GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
Molecular Weight55kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

CAMKK, CAMKKB

Similar Products

  • CAMKK2 Rabbit Polyclonal Antibody [orb100728]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Equine, Mouse, Porcine, Sheep

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • CAMKK2 Antibody (C-term) [orb1929544]

    IHC-P,  WB

    Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CAMKK2 Antibody (N-term G67) [orb37466]

    IHC-P,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • CAMKK2 Rabbit Polyclonal Antibody [orb625397]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • CAMKK2 Antibody [orb685272]

    ELISA,  IHC,  WB

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

CAMKK2 Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 3 ug/ml.

CAMKK2 Rabbit Polyclonal Antibody

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

CAMKK2 Rabbit Polyclonal Antibody

Sample Type: Human Fetal Liver, Antibody dilution: 1.0 ug/ml.

CAMKK2 Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HeLa.

CAMKK2 Rabbit Polyclonal Antibody

Sample Type: Human HepG2, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that CAMKK2 is expressed in HepG2.

CAMKK2 Rabbit Polyclonal Antibody

Sample Type: Human Jurkat, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in Jurkat.

CAMKK2 Rabbit Polyclonal Antibody

Sample Type: Human MCF7, Antibody dilution: 1.0 ug/ml. CAMKK2 is supported by BioGPS gene expression data to be expressed in MCF7.

CAMKK2 Rabbit Polyclonal Antibody

WB Suggested Anti-CAMKK2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:62500, Positive Control: 721_B cell lysate. There is BioGPS gene expression data showing that CAMKK2 is expressed in 721_B.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_705720

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

CAMKK2 Rabbit Polyclonal Antibody (orb581980)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 620.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry