You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb582177 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to CABYR |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rabbit, Rat |
Reactivity | Human |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 24kDa |
Target | CABYR |
UniProt ID | O75952 |
Protein Sequence | Synthetic peptide located within the following region: SKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSS |
NCBI | NP_722454 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | CT88, FSP2, CBP86, FSP-2, CABYRa, CABYRc, CABYRe, Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-CABYR Antibody, Titration: 1.0 ug/ml, Positive Control: HepG2 Whole Cell.
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Canine, Human, Sheep | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |