Cart summary

You have no items in your shopping cart.

C9orf57 Rabbit Polyclonal Antibody (FITC)

C9orf57 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2087331

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087331
CategoryAntibodies
DescriptionC9orf57 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityHuman, Mouse, Rabbit
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human C9orf57
Protein SequenceSynthetic peptide located within the following region: GLEIRMRRIVFAGVILFRLLGVILFRLLGVILFGRLGDLGTCQTKPGQYW
UniProt IDQ5W0N0
MW17kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesRP11-346E17.3
NoteFor research use only
NCBINP_001122090