Cart summary

You have no items in your shopping cart.

C9orf4 Rabbit Polyclonal Antibody (Biotin)

C9orf4 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2116228

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2116228
CategoryAntibodies
DescriptionC9orf4 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C9orf4
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW37kDa
UniProt IDQ9P0K9
Protein SequenceSynthetic peptide located within the following region: HDDNGRVRIQHFYNVGQWAKEIQRNPARDEEGVFENNRVTCRFKRPVNVP
NCBINP_055149
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesCG6, CG-6, DEE37, C9orf4, EIEE37
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.