Cart summary

You have no items in your shopping cart.

C9orf25 Rabbit Polyclonal Antibody (FITC)

C9orf25 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2104965

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104965
CategoryAntibodies
DescriptionC9orf25 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C9orf25
Protein SequenceSynthetic peptide located within the following region: SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
UniProt IDQ8IW50
MW18kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesC9orf25
NoteFor research use only
NCBINP_671735