Cart summary

You have no items in your shopping cart.

C3orf10 Rabbit Polyclonal Antibody (Biotin)

C3orf10 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2110867

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2110867
CategoryAntibodies
DescriptionC3orf10 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C3orf10
Protein SequenceSynthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
UniProt IDQ8WUW1
MW9kDa
Tested applicationsIHC, WB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesMDS027, hHBrk1, C3orf10, HSPC300
NoteFor research use only
NCBINP_060932
Expiration Date12 months from date of receipt.
  • HHBrk1 Rabbit Polyclonal Antibody (Biotin) [orb447114]

    ELISA,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Human, Mouse, Porcine, Rat

    Rabbit

    Polyclonal

    Biotin

    100 μl