C3orf10 Rabbit Polyclonal Antibody

• Catalog Number: orb325660
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BRK1
• Target: BRK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf10
• Protein Sequence: Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
• UniProt ID: Q8WUW1
• MW: 9kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti HSPC300 antibody, anti MDS027 antibody, anti
• Note: For research use only
• NCBI: NP_060932
• Expiration Date: 12 months from date of receipt.

Human Liver

WB Suggested Antibody Titration: 2.5 ug/mL, Positive Control: HepG2.