You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325660 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BRK1 |
Target | BRK1 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Porcine, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 1.0 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human C3orf10 |
Protein Sequence | Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK |
UniProt ID | Q8WUW1 |
MW | 9kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti HSPC300 antibody, anti MDS027 antibody, anti Read more... |
Note | For research use only |
NCBI | NP_060932 |
Expiration Date | 12 months from date of receipt. |
Human Liver
WB Suggested Antibody Titration: 2.5 ug/mL, Positive Control: HepG2.
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
IHC, WB | |
Bovine, Canine, Equine, Human, Mouse, Porcine, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
IHC | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |