Cart summary

You have no items in your shopping cart.

C2orf70 Rabbit Polyclonal Antibody (Biotin)

C2orf70 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2087035

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087035
CategoryAntibodies
DescriptionC2orf70 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Human, Rabbit
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human C2orf70
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW23kDa
UniProt IDA6NJV1
Protein SequenceSynthetic peptide located within the following region: TVLPPLCPKKKWHLLRLAPENLKTYQTFPSGKRVSPQERKKRDCYFEFRA
NCBINP_001098989
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC2orf70
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.