Cart summary

You have no items in your shopping cart.

C21orf13 Rabbit Polyclonal Antibody (FITC)

C21orf13 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2117457

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2117457
CategoryAntibodies
DescriptionC21orf13 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman, Yeast
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C21orf13
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW76kDa
UniProt IDO95447
Protein SequenceSynthetic peptide located within the following region: SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDY
NCBINP_689718
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesC21orf13
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.