Cart summary

You have no items in your shopping cart.

C18orf21 Rabbit Polyclonal Antibody (Biotin)

C18orf21 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2087680

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2087680
CategoryAntibodies
DescriptionC18orf21 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityHuman
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human C18orf21
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW24kDa
UniProt IDQ32NC0
Protein SequenceSynthetic peptide located within the following region: KTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHF
NCBINP_113634
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesXTP13, HsT3108, PNAS-124, PNAS-131
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.