Cart summary

You have no items in your shopping cart.

C16orf58 Rabbit Polyclonal Antibody (Biotin)

C16orf58 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2112691

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112691
CategoryAntibodies
DescriptionC16orf58 Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human C16orf58
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW51kDa
UniProt IDQ96GQ5
Protein SequenceSynthetic peptide located within the following region: QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN
NCBINP_073581
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesRUS, C16orf58
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.