NMES1 Rabbit Polyclonal Antibody

• Catalog Number: orb325545
• Category: Antibodies
• Description: Rabbit polyclonal antibody to C15orf48
• Target: C15orf48
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Protein Sequence: Synthetic peptide located within the following region: VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP
• UniProt ID: Q9C002
• MW: 9 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti FLJ22645 antibody, anti FOAP-11 antibody, ant
• Note: For research use only
• NCBI: NP_115789
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 3 ug/mL of the antibody was used in this experiment.

Sample Tissue: Human PANC1 Whole Cell, Antibody Dilution: 3 ug/mL.

WB Suggested Anti-C15orf48 Antibody, Titration: 1.0 ug/mL, Positive Control: PANC1 Whole Cell.