Cart summary

You have no items in your shopping cart.

C10orf57 Rabbit Polyclonal Antibody (FITC)

C10orf57 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2112402

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2112402
CategoryAntibodies
DescriptionC10orf57 Rabbit Polyclonal Antibody (FITC)
ClonalityPolyclonal
Species/HostRabbit
ConjugationFITC
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human C10orf57
Protein SequenceSynthetic peptide located within the following region: QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH
UniProt IDQ8TBM7
MW14kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesC10orf57, bA369J21.6
NoteFor research use only
NCBINP_079401