BUB3 Rabbit Polyclonal Antibody

• Catalog Number: orb584054
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BUB3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IF, IHC, WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Rabbit, Rat
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 36kDa
• Target: BUB3
• UniProt ID: A6NJ42
• Protein Sequence: Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
• NCBI: NP_001007794
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: BUB3L, hBUB3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Mouse Liver, Antibody dilution: 1 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. BUB3 is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells.

Rabbit Anti-BUB3 Antibody, Catalog Number: orb584054, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Nucleus, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Sample Type: HCT116, Primary Antibody dilution: 4 ug/ml, Secondary Antibody: Anti-rabbit Alexa 546, Secondary Antibody dilution: 2 ug/ml, Gene Name: BUB3.

WB Suggested Anti-BUB3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: PANC1 cell lysate. BUB3 is strongly supported by BioGPS gene expression data to be expressed in PANC1.