Cart summary

You have no items in your shopping cart.

BSND Rabbit Polyclonal Antibody (FITC)

BSND Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2098527

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2098527
CategoryAntibodies
DescriptionBSND Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Predicted ReactivityHuman, Porcine
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human BSND
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW35 kDa
UniProt IDQ8WZ55
Protein SequenceSynthetic peptide located within the following region: PGDVQAWMEAAVVIHKGSDESEGERRLTQSWPGPLACPQGPAPLASFQDD
NCBINP_476517
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesBART, DFNB73
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.