BRPF1 Rabbit Polyclonal Antibody

• Catalog Number: orb55760
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BRPF1.
• Target: BRPF1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Human
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BRPF1
• Protein Sequence: Synthetic peptide located within the following region: TSKGLGPNMSSTPAHEVGRRTSVLFSKKNPKTAGPPKRPGRPPKNRESQM
• UniProt ID: P55201
• MW: 133 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BR140, IDDDFP
• Note: For research use only
• NCBI: NP_001003694.1

Sample Tissue: Human Jurkat Whole Cell lysates, Antibody dilution: 1 ug/ml.