BRD7 Rabbit Polyclonal Antibody

• Catalog Number: orb576935
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BRD7
• Target: BRD7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Guinea pig, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human BRD7
• Protein Sequence: Synthetic peptide located within the following region: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV
• UniProt ID: Q9NPI1
• MW: 74kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BP75, NAG4, CELTIX1
• Research Area: Epigenetics & Chromatin, Protein Biochemistry
• Note: For research use only
• NCBI: NP_037395
• Expiration Date: 12 months from date of receipt.

Sample Type: Jurkat, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 2.5 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane, Gel Concentration: 12%. BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat.

Rabbit Anti-BRD7 antibody, Paraffin Embedded Tissue: Human Lung, cell Cellular Data: alveolar cell, Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate. BRD7 is supported by BioGPS gene expression data to be expressed in Jurkat.