Cart summary

You have no items in your shopping cart.

BPIFB6 Rabbit Polyclonal Antibody (FITC)

BPIFB6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2088702

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2088702
CategoryAntibodies
DescriptionBPIFB6 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityEquine, Guinea pig, Human, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N-terminal region of Human BPIFB6
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW50kDa
UniProt IDQ8NFQ5
Protein SequenceSynthetic peptide located within the following region: EKMAAEAGKKQPGMKPIKGITNLKVKDVQLPVITLNFVPGVGIFQCVSTG
NCBINP_777557
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesBPIL3, LPLUNC6
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.