You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1216279 |
---|---|
Category | Proteins |
Description | The Bovine IL-16 yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 applications are for cell culture, ELISA standard, and Western Blot Control. The Bovine IL-16 yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)) (Gene ID: 506314). |
Target | IL-16 |
Form/Appearance | Lyophilized |
Purity | 98% |
Protein Sequence | ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130) |
Protein Length | 130 |
MW | 13.3 kDa |
Source | Yeast |
Biological Origin | Bovine |
Storage | -20°C |
Note | For research use only |