Cart summary

You have no items in your shopping cart.

Bovine IL-16 protein

SKU: orb1215678

Description

The Bovine IL-16 Biotinylated yeast-derived recombinant protein is not tagged and is naturally endotoxin-free. The purity is greater than 98% as visualized by SDS-PAGE analysis. Bovine IL-16 Biotinylated applications are for cell culture. Bovine IL-16 Biotinylated yeast-derived recombinant protein can be purchased in multiple sizes. Bovine IL-16 Biotinylated Specifications: (Molecular Weight: 13.3 kDa) (Amino Acid Sequence: ATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)) (Gene ID: 506314).

Images & Validation

Key Properties

SourceYeast
Biological OriginBovine
TargetIL-16
Molecular Weight13.3 kDa
Protein Length130.0
Protein SequenceATTDLNSSTDSSGSASVTSDVSIESAEATVCTVTLEKTSAGLGFSLEGGKGSLHGDKPLTVNRIFKGLASEQSDTVQPGDEIVHLAGTAMQGLTRFEAWNIIKALPDGPVTIVLRRKSLQSKGTPAAGDP (130)
Purity98%

Storage & Handling

Storage-20°C
Form/AppearanceLyophilized
Expiration Date6 months from date of receipt.
DisclaimerFor research use only

Similar Products

  • Bovine IL-16 protein [orb1216279]

    98%

    13.3 kDa

    Yeast

    500 μg, 5 μg, 25 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Bovine IL-16 protein (orb1215678)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

10 μg
$ 340.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry