BMP7 Rabbit Polyclonal Antibody

• Catalog Number: orb574141
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BMP7
• Target: BMP7
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BMP7
• Protein Sequence: Synthetic peptide located within the following region: QGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQ
• UniProt ID: P18075
• MW: 49 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: OP-1
• Research Area: Cell Biology, Epigenetics & Chromatin, Signal Tran
• Note: For research use only
• NCBI: NP_001710

Human kidney

Sample Type: Human Thyroid, Antibody dilution: 1.0 ug/ml.

Positive control (+): 293T (2T), Negative control (-): HepG2 (HG), Antibody concentration: 1 ug/ml.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Recommended dilution for this antibody is 1-3 ug/ml.

Sample Tissue: Human NCI-H226, Antibody dilution: 1.0 ug/ml.

WB Suggested Anti-BMP7 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.