You have no items in your shopping cart.
Cart summary
Item 1 of 1
BMP3 Rabbit Polyclonal Antibody
Catalog Number: orb331243
| Catalog Number | orb331243 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to BMP3 |
| Target | BMP3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Protein Sequence | Synthetic peptide located within the following region: EKSKNKKKQRKGPHRKSQTLQFDEQTLKKARRKQWIEPRNCARRYLKVDF |
| UniProt ID | P12645 |
| MW | 52kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti BMP-3A antibody |
| Note | For research use only |
| NCBI | NP_001192 |
WB Suggested Anti-BMP3 Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Heart.
- Item 1 of 4
- Item 1 of 4
BMP-3A Polyclonal Antibody [orb1411467]
IHC-P, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
100 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 3
