Cart summary

You have no items in your shopping cart.

BICRA Rabbit Polyclonal Antibody (Biotin)

BICRA Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2090503

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2090503
CategoryAntibodies
DescriptionBICRA Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Gltscr1
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW161kDa
UniProt IDF8VPZ9
Protein SequenceSynthetic peptide located within the following region: FIQEEKTTLALDKQLAKEKPDEYVSSSRSLGFPVPVSSEGHRLPSHGQSS
NCBINP_001074887
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesGlts, Gltscr1
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.