BHMT Rabbit Polyclonal Antibody

• Catalog Number: orb330184
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BHMT
• Target: BHMT
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Rat
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BHMT
• Protein Sequence: Synthetic peptide located within the following region: AVEHPEAVRQLHREFLRAGSNVMQTFTFYASEDKLENRGNYVLEKISGQE
• UniProt ID: Q93088
• MW: 45kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BHMT1 antibody
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• NCBI: NP_001704

Sample Type: 293T, Antibody Dilution: 1.0 ug/mL.

Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT.

Lanes: Lane 1: 20 ug rat liver lysate, Primary Antibody Dilution: 1:2000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody Dilution: 1:15000, Gene Name: BHMT.

Rabbit Anti-BHMT Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-BHMT Antibody, Titration: 2.5 ug/mL, Positive Control: Human Fetal Liver cell lysate.