BHLHE40 antibody

• Catalog Number: orb324508
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BHLHE40
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep
• Reactivity: Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BHLHB2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 45 kDa
• Target: BHLHE40
• UniProt ID: O14503
• Protein Sequence: Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE
• NCBI: NP_003661
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti DEC1 antibody, anti SHARP-2 antibody, anti ST
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Western blot analysis of Transfected 293T tissue using BHLHE40 antibody

Immunohistochemical staining of human Lung tissue using BHLHE40 antibody

Western blot analysis of human Fetal Lung tissue using BHLHE40 antibody

Western blot analysis of human Placenta tissue using BHLHE40 antibody