You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb324508 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BHLHE40 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | IHC, WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human BHLHB2 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 45 kDa |
Target | BHLHE40 |
UniProt ID | O14503 |
Protein Sequence | Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE |
NCBI | NP_003661 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti DEC1 antibody, anti SHARP-2 antibody, anti ST Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.
Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.
Rabbit Anti-BHLHE40 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.
WB Suggested Anti-BHLHB2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |