BHLHB2 Rabbit Polyclonal Antibody

• Catalog Number: orb324508
• Category: Antibodies
• Description: Rabbit polyclonal antibody to BHLHE40
• Target: BHLHE40
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BHLHB2
• Protein Sequence: Synthetic peptide located within the following region: SEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQESEEPPTKKNRMQLSDDE
• UniProt ID: O14503
• MW: 45 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti DEC1 antibody, anti SHARP-2 antibody, anti ST
• Research Area: Epigenetics & Chromatin, Stem Cell & Developmental
• Note: For research use only
• NCBI: NP_003661
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/mL.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/mL.

Rabbit Anti-BHLHE40 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/mL, Magnification: 400X.

WB Suggested Anti-BHLHB2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Transfected 293T.