You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577083 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to BATF3 |
Target | BATF3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Yeast |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human BATF3 |
Protein Sequence | Synthetic peptide located within the following region: MSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQ |
UniProt ID | Q9NR55 |
MW | 14 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | JDP1, SNFT, JUNDM1 |
Note | For research use only |
NCBI | NP_061134 |
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 1 ug/ml.
Positive control (+): 293T (2T), Negative control (-): Human liver (LI), Antibody concentration: 3 ug/ml.
WB Suggested Anti-BATF3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Yeast | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Yeast | |
Rabbit | |
Polyclonal | |
FITC |